Pop drop · Free shipping over $55 · Squiggle sale

Recombinant Rat Prostacyclin receptor(Ptgir) Primary Antibody Gene Names:Name:lgt1 Ordered Locus Names:SCO2034

SKU 77920165786
4.5
USD1239.70 USD1275.70

Pay in 4 interest-free payments of $309.93 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Description

Gene Names:Name:lgt1 Ordered Locus Names:SCO2034 ORF Names:SC4G6

Granzier H

AA Sequence:MALVPCQVLRVAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLT DLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRL LDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVT GMWVYPFLEHIGSGARIIFFGSTTILMNFLYLLGEVLNSYIWDTQRTKAPSCQDTQSSLS CAKPVQNLCKDTFMLEGGKARA

Gene Names: Ptma

Recombinant Rat Prostacyclin receptor(Ptgir) Primary Antibody Gene Names:Name:lgt1 Ordered Locus Names:SCO2034Size: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Rattus norvegicus (Rat) Uniprot NO.: P43253 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris based buffer,50% glycerol, optimized for this protein Storage: Store at 20, for extended storage, conserve at 20 or 80. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 for up to one week. AA

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products